PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P27540_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 350aa    MW: 38876.9 Da    PI: 5.6196
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P27540_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.5e-092733111755
                            HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            el +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  GSMUA_Achr7P27540_001 273 ELHYKWPYPSETQKVALAESTGLDLKQINNWFINQRKRH 311
                            5556789*****************************885 PP

2ELK39.79.9e-14231252122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKhqLlrKYsgyL+sL+qE+s
  GSMUA_Achr7P27540_001 231 ELKHQLLRKYSGYLSSLRQELS 252
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.0E-2286130IPR005540KNOX1
PfamPF037903.2E-2487129IPR005540KNOX1
SMARTSM012562.0E-27137188IPR005541KNOX2
PfamPF037911.0E-23143186IPR005541KNOX2
SMARTSM011881800146166IPR005539ELK domain
PfamPF037891.2E-10231252IPR005539ELK domain
PROSITE profilePS5121311.592231251IPR005539ELK domain
SMARTSM011887.2E-8231252IPR005539ELK domain
PROSITE profilePS5007112.536251314IPR001356Homeobox domain
SuperFamilySSF466891.37E-19252327IPR009057Homeodomain-like
SMARTSM003892.0E-12253318IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27256316IPR009057Homeodomain-like
CDDcd000861.71E-12263315No hitNo description
PfamPF059203.8E-16271310IPR008422Homeobox KN domain
PROSITE patternPS000270289312IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEEFSQLGGN LWGGLMCSTS PAAKSTGDTG AVAMVAPPSG GASVFDKGHG CIPNPLLLGS  60
GGNQNSHLLA KHEGASSSHF PPCDVDAIKA KIISHPQYSS LLAAYIDCQK VGAPPEVVDR  120
LSAVAQELEM RQRASLICRD APTDPELDQF MEAYHEMLVK YREELTRPLQ EAMEFLRRVE  180
AQLNSLSLTD GSLRILSADD KFGVCSSEDD QDGSGGETEL PELDASAEDR ELKHQLLRKY  240
SGYLSSLRQE LSKKKKKGKL PKDARQQLLN WWELHYKWPY PSETQKVALA ESTGLDLKQI  300
NNWFINQRKR HWKPSEDMQF VVMDGYHAPN AALYMDGQYF MGDGLYRLGP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411331.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ434841e-144KNOX3_HORVU; Homeobox protein KNOX3
TrEMBLM0TL900.0M0TL90_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27540_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-117KNOTTED-like from Arabidopsis thaliana